PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04464.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 282aa    MW: 32649.9 Da    PI: 9.3369
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04464.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-52251492128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                               pGfrFhPtdeelv +yL++kve++++++ e ik++diyk+ePwdLpk+ +++ekewyfF+kr +ky+++ r+nr+t sg+Wkatg
  Sme2.5_04464.1_g00002.1  25 LPGFRFHPTDEELVGFYLRRKVEKRPINI-ELIKQIDIYKYEPWDLPKSSSKGEKEWYFFCKRGRKYRNSIRPNRVTGSGFWKATG 109
                              59***************************.89***************88888999******************************* PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               dk+v+s +ge +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  Sme2.5_04464.1_g00002.1 110 IDKPVYS-GGECIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 149
                              *******.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.30924180IPR003441NAC domain
SuperFamilySSF1019411.57E-5624180IPR003441NAC domain
PfamPF023655.9E-2626149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSNLVTSSTK YYTAKKDEEE DEVALPGFRF HPTDEELVGF YLRRKVEKRP INIELIKQID  60
IYKYEPWDLP KSSSKGEKEW YFFCKRGRKY RNSIRPNRVT GSGFWKATGI DKPVYSGGEC  120
IGLKKSLVYY RGSAGKGTKT DWMMHEFRLP AQNEKSTKHI QANTIPQQAE VWTLCRIFKR  180
NGSYKNKCTA AEWRAAAKRN LVVDSQTCSV DSCSDYIISF GAPAKHNTEI ISGHVYQDMM  240
ISTNNQQLCN TAQRPSSDAN EYVNYWDELR SILELVQQQW RS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-522618319168NO APICAL MERISTEM PROTEIN
1ut4_B2e-522618319168NO APICAL MERISTEM PROTEIN
1ut7_A2e-522618319168NO APICAL MERISTEM PROTEIN
1ut7_B2e-522618319168NO APICAL MERISTEM PROTEIN
3swm_A3e-522618322171NAC domain-containing protein 19
3swm_B3e-522618322171NAC domain-containing protein 19
3swm_C3e-522618322171NAC domain-containing protein 19
3swm_D3e-522618322171NAC domain-containing protein 19
3swp_A3e-522618322171NAC domain-containing protein 19
3swp_B3e-522618322171NAC domain-containing protein 19
3swp_C3e-522618322171NAC domain-containing protein 19
3swp_D3e-522618322171NAC domain-containing protein 19
4dul_A2e-522618319168NAC domain-containing protein 19
4dul_B2e-522618319168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015163599.11e-133PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK556e-94NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM1DK551e-133M1DK55_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000903271e-132(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-95NAC domain containing protein 42